14 March 2010 [Sunday] @ March 14, 2010 edit
H5N1 returns to GermanyBird flu returns to Germany
Health News
Oct 9, 2008, 15:16 GMT
Dresden, Germany - Bird flu has returned to Germany, with the H5N1 influenza virus breaking out among farm ducks in the eastern state of Saxony, officials said Thursday.
It was the first proven appearance of the disease this year in Germany. Officials were preparing to slaughter the whole flock of ducks at Goerlitz, near the Polish border.
Germany's national animal health laboratory on the Baltic island of Riems said the find was 'somewhat surprising' as the infection alert had been reduced to moderate after an outbreak was beaten last December.
It remained unknown what proportion of German wild birds were infected, a spokeswoman said. Currently none of Germany's neighbours were reporting any H5N1 finds and the virus had only shown up in Asia in recent months.
The virus can infect people if hygienic precautions are not followed and can kill, but human-to-human infection has only happened in very rare cases, mainly in Asia. Scientists fear the virus could mutate into a human disease causing mass death.
http://www.fli.bund.de/fileadmin/user_upload/Dokumente/News/aktuelle_Krankheitsgeschehen/avi_Flu/080424_lb_influenza.pdf
2785
Google translation from Polish:
Lower Silesia in danger of avian influenza
On Thursday the H5N1 virus detected in ducks from the farm poultry in the village in the district Markersdorf Goerlitz. Preparations for the liquidation of poultry reared on the farm - hundreds of ducks and geese. Duck infected with the virus, the first this year in the case of Germany, the emergence of the virus. Previous reported in December 2007 in poultry in Brandenburg.
In connection with the detection of the virus in Germany close to the border with Poland, Kazimierz district veterinarian Szyposzyński on Friday issued a regulation "on the infected area and in danger of the occurrence of highly pathogenic avian influenza (...), how the marks of the area and prohibitions and orders in force in this area. "
As is clear from the regulation, in the affected area has banned inter alia, exporting and spreading litter and natural fertilizer poultry without the consent of a veterinarian, the movement of poultry and other birds living in captivity outside the threatened area for 21 days, the organization of hunting and harvesting wild birds, organizing trade fairs, shows and exhibitions.
In addition, district veterinary doctor ordered to draw up an inventory of remaining poultry farms, carry out checks on farms combined with a study of poultry, poultry separate button on the farm and carry out checks on vehicles carrying poultry and offal.
At the border crossing points and at the railway will be taught in Zgorzelec disinfection mats.
(jks)
http://www.fli.bund.de/1324.html
http://www.recombinomics.com/News/10090801/H5N1_Germany_Fujian.html
10 Oct 2008 14:25:30 GMT
Source: Reuters
HAMBURG, Oct 10 (Reuters) - German authorities said on Friday that the lethal strain of bird flu has been confirmed on a farm in the east of the country.
Germany's eastern state government of Saxony said the H5N1 bird flu strain had been confirmed in a duck at a poultry farm near Dresden.
"Tests have confirmed that this involves the highly contagious version of the H5N1 virus epidemic," said Ralph Schreiber, spokesman for Saxony's social welfare ministry.
The flu strain was detected during a routine examination at the farm, which held some 1,400 birds. All birds at the farm have been slaughtered as a precaution, the state said.
A 3-km (2-mile) radius quarantine zone has been established around the farm and a 10-km radius observation zone also was established in which all poultry must be locked up in buildings.
Bird flu was last detected in farm birds in Germany in December 2007.
The virus has infected 387 people worldwide in 15 countries, killing 245 of them, according to the World Health Organization's Aug. 10 tally. Indonesia has the highest toll of any nation.
Although bird flu remains an animal disease, experts fear that the virus might mutate into a form easily passed from human to human.
(Reporting by Michael Hogan; Editing by Michael Roddy)
http://www.alertnet.org/thenews/newsdesk/LA581291.htm
| Germany confirms outbreak of H5N1 bird flu -EU |
BRUSSELS, Oct 10 (Reuters) - Germany has informed European Union animalhealth experts of an outbreak of H5N1 bird flu, the EU's first case of thelethal strain of the contagious disease in poultry this year, the EuropeanCommission said on Friday. The outbreak occurred in the German state of Saxony, close to the borderwith Poland, the Commission said in a statement. "Strict movement controls are in place. Poultry must be kept indoors,gatherings of poultry and other birds are banned, and on-farm biosecuritymeasures are strengthened," it said. (Reporting by Jeremy Smith) Keywords: BIRDFLU EU/GERMANY tf.TFN-Europe_newsdesk@thomsonreuters.com http://orange.advfn.com/news_Germany-confirms-outbreak-of-H5N1-bird-flu-EU_28652382.html |
By Naomi Kresge
Oct. 10 (Bloomberg) -- German authorities killed 1,400 ducks, geese, chickens and turkeys after identifying the country's first case of avian influenza this year on a commercial farm in the town of Markersdorf, near the Polish border.
A duck tested positive for the H5N1 (http://www.bloomberg.com/apps/quote?ticker=H5N1TOTC%3AIND) strain of bird flu, Elke Reinking, a spokeswoman for Germany's Friedrich Loeffler Institute, said in a telephone interview. Tests are being conducted to determine whether the bird was infected with the most deadly form of the disease, she said.
Authorities began killing poultry at 4 a.m. and have set up a three-kilometer (1.9 mile) quarantine, said Ralph Schreiber, a Health Ministry spokesman in the German state of Saxony. The sick duck was found in an area with several poultry farms, including one with 70,000 animals, Schreiber said.
``The flu can appear again at any time, but it was a bit of a surprise to see it in a commercially raised animal,'' Reinking said. The Friedrich Loeffler Institute is a center for animal health.
Avian flu was last found in Germany in December 2007 in chickens at a small hobby farm, she said. There have been no reports of the disease in neighboring countries since March, when a wild duck tested positive in Switzerland.
To contact the reporter on this story: Naomi Kresge (http://search.bloomberg.com/search?q=Naomi+Kresge&site=wnews&client=wnews&proxystylesheet=wnews&output=xml_no_dtd&ie=UTF-8&oe=UTF-8&filter=p&getfields=wnnis&sort=date:D:S:d1) in Berlin nkresge@bloomberg.net (nkresge@bloomberg.net)
Last Updated: October 10, 2008 06:56 EDT
http://www.bloomberg.com/apps/news?pid=20601202&sid=anbjeVSZ43tU&refer=healthcare
SMS - Gesundheit, Landwirtschaft/Forst
Verdacht von Influenza A-Virus in einem Nutzgeflügelbestand
Am späten Abend des 08.10.2008 wurde das Sächsische Staatsministerium für Soziales darüber informiert, dass bei einer Ente in einem Nutzgeflügelbestand im Direktionsbezirk Dresden, Landkreis Görlitz Influenza A Subtyp H5 N1 nachgewiesen wurde. Weitere Untersuchungen zur Feststellung, ob es sich um den gefährlichen (hochpathogenen) Typ handelt wurden eingeleitet.
Durch das Lebensmittelüberwachungs- und Veterinäramt des Landkreises Görlitz wurde daraufhin Geflügelpestverdacht festgestellt. Der Bestand wurde bereits durch den Amtstierarzt gesperrt. Die eventuelle Bestandstötung und weitere Maßnahmen werden vorsorglich vorbereitet.
Die durch hoch pathogene aviäre Influenzaviren der Subtypen H5 und H7 hervorgerufene Geflügelpest ist eine in der Tiermedizin seit Ende des 19. Jahrhunderts bekannte Infektionskrankheit, die bevorzugt Hühnervögel und Puten, aber auch Wassergeflügel wie Enten und Gänse befällt. Diese „Vogelgrippe“, wie sie in der Öffentlichkeit bezeichnet wird, ist eine Tierseuche, welche bei Einschleppung in Nutzgeflügelbestände hohe Verluste verursachen kann und deshalb frühzeitig Maßnahmen erfordert.
www.sms.sachsen.de
http://www.medienservice.sachsen.de/news/32006
-
[Google Machine Translation - ioh]
09.10.2008
SMS - health, agriculture / forestry
Suspicion of influenza A virus in a Nutzgeflügelbestand
Late on the evening of 08.10.2008 was the Saxon State Ministry of Social Affairs informed that a duck in a Nutzgeflügelbestand Directorate in the Dresden district, county Goerlitz influenza A subtype H5 N1 has been demonstrated. Further investigation to determine whether it is dangerous (highly) type were launched.
By the Food and Veterinary Office of the District of Goerlitz was then suspected avian influenza detected. The stock was already covered by the official veterinarian locked. The eventual killing stock and other precautionary measures will be prepared.
The highly pathogenic avian influenza virus subtypes H5 and H7 avian influenza is caused in animal medicine since the end of the 19th Century-known infectious disease, the birds prefer chickens and turkeys, but also water birds such as ducks and geese attacks. This "bird flu", as they are in the public called, is an animal disease, which if introduced into Nutzgeflügelbestände can cause heavy losses and therefore requires early action.
www.sms.sachsen.de
-
-----
http://www.medienservice.sachsen.de/news/32006
posted: October 09, 2008
BERLIN, OCT 9 (BNA)-- BIRD FLU REAPPEARED IN GERMANY AS A DUCK WAS FOUND H5N1 POSITIVE IN A FARM IN THE SOUTH OF THE COUNTRY.
SOURCES FROM THE LOCAL HEALTH AUTHORITIES IN DRESDEN THAT THIS WAS THE FIRST APPEARANCE FOR THE DISEASE IN GERMANY THIS YEAR. THE SOURCES ADDED THAT THE DUCKS IN THE FARM WILL BE SLAUGHTERED AND THAT OTHER PREVENTIVE MEASURES WILL BE TAKEN TO LIMIT THE SPREAD OF THE DISEASE. GERMANYS NATIONAL ANIMAL HEALTH LABORATORY SAID THE FIND WAS SOMEWHAT SURPRISING AS THE INFECTION ALERT HAD BEEN REDUCED TO MODERATE AFTER AN OUTBREAK WAS BEATEN LAST DECEMBER. THE LAST FIND OF THE DISEASE WAS IN THE GERMAN STATE OF BRANDENBURG0 NTQ/ 09-OCT-2008 21:41
http://english.bna.bh/newsadmin/printable.php?ID=73361
[English PDF reports (LINK (https://www.oie.int/wahid-prod/reports/en_imm_0000007416_20081010_154629.pdf))]
Highly pathogenic avian influenza, Germany
Information received on 10/10/2008 from Mr Werner Zwingmann, Ministerialdirigent, "Leiter der Unterabteilung Tiergesundheit und Lebensmittelhygiene", Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (BMELV) , Bonn, Germany
§ Summary
Report type Immediate notification
Start date 09/10/2008
Date of first confirmation of the event 10/10/2008
Report date 10/10/2008
Date submitted to OIE 10/10/2008
Reason for notification Reoccurrence of a listed disease
Date of previous occurrence 28/01/2008
Causal agent Highly pathogenic avian influenza virus Serotype H5N1
Nature of diagnosis Laboratory (basic), Laboratory (advanced)
This event pertains to a defined zone within the country
§ New outbreaks
Summary of outbreaks Total outbreaks: 1
* Outbreak Location and Affected population: SACHSEN (Markersdorf, Niederschlesischer Oberlausitzkreis - Landkreis Görlitz) :
In the establishment affected there are 800 geese, 550 ducks, 60 chicken and 24 turkeys.
Total animals affected: Species - Susceptible - Cases - Deaths - Destroyed - Slaughtered
* Birds - 1434 - 1 - 0 - 1434 - 0
Outbreak statistics: Species - Apparent morbidity rate - Apparent mortality rate - Apparent case fatality rate - Proportion susceptible animals lost*
* Birds - 0.07% - 0.00% - 0.00% - 100.00%
* Removed from the susceptible population through death, destruction and/or slaughter
§ Epidemiology
Source of the outbreak(s) or origin of infection Unknown or inconclusive
§ Epidemiological comments
There were no movements of animals into or out of the holding concerned within the last 21 days.
The detection of HPAI H5N1 was performed in relation to routine laboratory investigation.
§ Control measures
Measures applied Control of wildlife reservoirs
Stamping out
Movement control inside the country
Screening
Zoning
Disinfection of infected premises/establishment(s)
Dipping / Spraying
Vaccination prohibited
No treatment of affected animals
Measures to be applied No other measures
§ Diagnostic test results
Laboratory name and type Friedrich-Loeffler Institute (National laboratory)
Tests and results: Species - Test - Test date - Result
* Birds - polymerase chain reaction (PCR) - 10/10/2008 - Positive
§ Future Reporting
The event is continuing. Weekly follow-up reports will be submitted.
-
------
http://www.recombinomics.com/News/10100801/H5N1_Saxony_Fujian.htmlCommentary
HPAI H5N1 Confirmed in Saxony Germany
Recombinomics Commentary 17:25
October 10, 2008
In the establishment affected there are 800 geese, 550 ducks, 60 chicken and 24 turkeys.
There were no movements of animals into or out of the holding concerned within the last 21 days.
The detection of HPAI H5N1 was performed in relation to routine laboratory investigation.
With several animals referring to the bird flu virus were present. “It was not only a duck”, said district administrator long one.
The above comments from the recently file OIE report (https://www.oie.int/wahid-prod/reports/en_imm_0000007416_20081010_154629.pdf), and the media translation described the HPAI H5N1 outbreak in Saxony (see satellite map (http://maps.google.com/maps/ms?ie=UTF8&hl=en&msa=0&msid=106484775090296685271.000434e9d3e9066b4203c&ll=51.279958,14.975739&spn=3.154111,7.437744&z=7)) . The H5N1 PCR positive was initially (http://www.recombinomics.com/News/10090801/H5N1_Germany_Fujian.html) found in one duck, but the media report indicates more birds have tested positive, and throat swabs have been collected with humans linked to the outbreak.
The finding of HPAI H5N1 increases the likelihood that the H5N1 will be clade 2.3 (Fujian) although the outbreak may be a re-emergence of the clade 2.2 (Qinghai / Uvs Lake strain), which was widespread in Europe, including Germany (http://www.recombinomics.com/News/07210701/H5N1_Endemic_Europe.html), last season.
Clade 2.3 (http://www.recombinomics.com/News/05190803/H5N1_232_234.html) was reported last spring for South Korea (http://www.recombinomics.com/News/05210802/H5N1_Japan_Korea_Match.html), Japan (http://www.recombinomics.com/News/05190801/H5N1_Hokkaido_M230I.html), and Russia (http://www.recombinomics.com/News/09280801/Russia_Fujian_Spread.html), which included wild bird outbreaks in Japan and Russia, raising concerns of migration of clade 2.3 to Europe this season.
Sequence data on these new infections in Germany would be useful.
.
Posted: 11 October 2008 0102 hrs
| http://www.channelnewsasia.com/imagegallery/store/phpUVY6Zr.jpg | ||||||
German authority inspects a poultry farm that was infected with the H5N1 bird flu virus. | ||||||
BRUSSELS : German authorities were culling poultry at a farm in Germany after the discovery of a case of the deadly H5N1 bird flu virus, the European Commission announced on Friday.
It is the first case of the highly pathogenic avian influenza at a farm in the European Union this year, although in February there was a confirmed outbreak among wild birds in Britain.
The H5N1 strain which first emerged in Asia in 2003, has caused some 245 deaths in humans since then, with Indonesia and Vietnam among the worst hit countries, according to World Health Organisation figures.
Scientists fear that H5N1 will eventually mutate into a form that is much more easily transmissible between humans, triggering a global pandemic.
The German authorities informed Brussels on Thursday of the outbreak in Saxony, near the Polish border, and have set up the required "risk areas" around the outbreak, the commission said in a statement.
The German authorities have also culled all poultry on the farm including some 1,350 geese and ducks and 65 chickens and turkeys.
The commission said the Germans had applied all the necessary measures to deal with the outbreak, including setting up a three kilometre radius protection zone -- with very strict rule on entering and exiting of animals and people -- and a wider 10 kilometre surveillance zone.
- AFP /ls
http://www.channelnewsasia.com/stories/afp_world/view/381942/1/.html
[from European Centre of Diseases Prevention and Control (ECDC)]
10th October 2008
The German authorities have confirmed the presence of highly pathogenic A(H5N1) in a mixed poultry holding containing approximately 1500 poultry. All birds on the farm have been culled, and the containment measures taken in accordance with EU veterinary legislation.
Investigations into the source of the outbreak are ongoing.
ECDC Comment (2008-10-10):
This is the first case of A(H5N1) to be reported within the EU in 2008. Investigations into the source of the outbreaks are ongoing, and it is premature to speculate on what that might be.
However, there have been no cases reported from ongoing surveillance activities in wild birds in the EU, and hence there is little to suggest that the virus is widely disseminated within the EU at the current time.
Currently the H5N1 virus remains primarily an infection of birds and current evidence suggests that all H5N1 viruses identified to date remains poorly adapted to humans.
Hence the risks to public health remain very low.
However, it remains important for people who may be considered to be at risk, such as those who keep poultry, to take sensible precautions to minimise the already very low risk of infection.
-
http://ecdc.europa.eu/en/health_content/episu/081009_av_ah.aspx
-----
http://www.stern.de/politik/panorama/:Vogelgrippe-Hochansteckende-Virus-Form-Sachsen/641942.html
The Associated Press
Friday, October 10, 2008
DRESDEN, Germany: A health official says 1,400 birds have been slaughtered at a poultry farm in eastern Germany after a duck tested positive for the H5N1 strain of the bird flu virus.
Saxony state health ministry spokesman Ralph Schreiber said Friday that the farm's entire stock of ducks, geese, turkeys and chickens was slaughtered overnight.
The farm near Goerlitz on the Polish border has been sealed off to prevent the spread of the virus. Birds at other poultry farms in the region are being checked.
Germany has seen several cases of bird flu in the past — most recently last December.
The disease has ravaged poultry stocks in Asia. Though bird flu is difficult for people to catch, the H5N1 strain has killed at least 206 people worldwide.
http://www.iht.com/bin/printfriendly.php?id=16843431
Bird flu breaks out again in Germany In the district Görlitz was proven in a utilizable poultry existence with a duck of the Subtyp H5N1, nor it is however examined whether it concerns the high-sticking on H5N1-Variante. The existence of the village with Görlitz, about 1400 animals, is killed however as a precaution.
Bird flu virus reaches the European Union in Germany the bird flu again broke out. In the district Görlitz was proven in a utilizable poultry existence with a duck of the Subtyp H5N1, communicated the Saxonian Social Department on Thursday. „It is examined at present whether it concerns, said the high-sticking on H5N1-Variante “ministerial spokesman Ralph writer. The samples were analyzed by the Friedrich Loeffler institute on the Baltic island Riems. The existence in a village with Görlitz is killed as a precaution, continued to say the speaker. Under it 700 geese concern 1400 animals. The enterprise is closed. The virus was determined during a routine investigation. The duck showed no disease symptoms. Additional 150 samples were taken, in order to see whether the virus already spread in the existence. In Saxonia 2006 in a utilizable animal existence the bird flu had been proven last. Past year was determined according to data of writer with seven wild birds the virus
http://www.badisches-tagblatt.de/html/unterticker/00_20081009174904_Vogelgrippe_zurueck_in_Deutschla nd___Ente_infi.html
http://www.thueringer-allgemeine.de/ta/ta.wirtschaft.volltext.php?kennung=on5taWIRWirNati onal39730&zulieferer=ta&kategorie=WIR&rubrik=Wirtschaft®ion=National&auftritt=TA&dbserver=1
http://www.derwesten.de/nachrichten/wp/2008/10/10/news-82590690/detail.html
|
http://www.sz-online.de/nachrichten/artikel.asp?id=1964080
Google tranlation:
(Poland) Communication from the Sanitary Inspectorate - avian flu in the western neighbors
* 2008-10-13 10:34:00
The State Sanitary Inspectorate, in connection with the detection in Germany, in the area of Goerlitz, on a farm poultry avian influenza virus H5N1 has taken action przeciwepidemiczne - Audit reported in a special message.
9 October (Thursday) Dolnośląski provincial veterinarian informed the duty operational Provincial Crisis Management Center (WCZK) in Wroclaw a statement in Germany, in the area of Goerlitz, on a farm poultry avian influenza virus H5N1.
In connection with those circumstances the State Sanitary Inspectorate staff immediately contacted the District Crisis Management Center in Zgorzelec, in order to take immediate steps to minimize risks in the area of the district zgorzeleckiego.
Have been strengthened patrols at the border, with particular emphasis on importation of fowl, fresh meat and other poultry products into the English.
Is now under way to determine whether at the farm in Germany, the Poles were employed and whether the meat from contaminated farms was exported to Poland. Through the local media is also shares information on the province of Lower Silesia.
More at:
http://www.gis.gov.pl/index.php?option=com_content&task=view&id=663&Itemid=50
http://www.recombinomics.com/News/10100801/H5N1_Saxony_Fujian.html
LOCUS AM403155 538 bp RNA linear VRL 18-MAR-2008
DEFINITION Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1)) partial NA
gene for neuraminidase, genomic RNA.
ACCESSION AM403155
VERSION AM403155.1 GI:136054170
KEYWORDS NA gene; neuraminidase.
SOURCE Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1))
ORGANISM Influenza A virus (A/tufted duck/Germany/R1240/06(H5N1)) (http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=404928)
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1
AUTHORS Starick,E., Beer,M., Hoffmann,B., Staubach,C., Werner,O.,
Globig,A., Strebelow,G., Grund,C., Durban,M., Conraths,F.J.,
Mettenleiter,T. and Harder,T.
TITLE Phylogenetic analyses of highly pathogenic avian influenza virus
isolates from Germany in 2006 and 2007 suggest at least three
separate introductions of H5N1 virus
JOURNAL Vet. Microbiol. 128 (3-4), 243-252 (2008)
PUBMED 18031958 (http://www.ncbi.nlm.nih.gov/sites/entrez?cmd=Retrieve&db=pubmed&list_uids=18031958)
REFERENCE 2 (bases 1 to 538)
AUTHORS Starick,E.
TITLE Direct Submission
JOURNAL Submitted (19-SEP-2006) Starick E., Fed. Res. Inst. for Animal
Health, Fr.-Loeffler-Institut, Boddenblick 5a, 17493
Greifswald-Insel Riems, GERMANY
FEATURES Location/Qualifiers
source 1..538
/organism="Influenza A virus (A/tufted
duck/Germany/R1240/06(H5N1))"
/virion
/mol_type="genomic RNA"
/strain="A/tufted duck/Germany/R1240/06"
/serotype="H5N1"
/db_xref="taxon:404928 (http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=404928)"
/country="Germany"
gene (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=136054170&from=1&to=538&view=gbwithparts) <1..>538
/gene="NA"
CDS (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=136054170&from=1&to=538&view=gbwithparts) <1..>538
/gene="NA"
/codon_start=3
/product="neuraminidase"
/protein_id="CAL48246.1 (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=CAL48246.1)"
/db_xref="GI:136054171"
/db_xref="GOA:A4H1V7"
/db_xref="InterPro:IPR001860 (http://www.ebi.ac.uk/interpro/ISearch?mode=ipr&query=IPR001860)"
/db_xref="UniProtKB/TrEMBL:A4H1V7 (http://www.uniprot.org/entry/A4H1V7)"
/translation="WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC
VNGSCFTVMTDGPSSGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYP DAGEITCV
CRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPN GAYGVKGF
http://www.focus.de/politik/schlagzeilen?day=20081009&did=924975
http://ec.europa.eu/food/committees/regulatory/scfcah/animal_health/presentations/ai_15102008_de.pdf
8.10. confirmation AI H5N1 by national reference lab, sequencing ongoing – first results indicated the presence of a HPAIV almost identical to the strain found in a tufted duck (Aythya fuligula) from the lake of Bautzen in 2006
Google translation:
Geflügelhof bird flu detected in Saxony
Dresden (AP) In Germany, there is the first time since months ago another case avian flu. When a duck in a Geflügelhof in Saxony was the H5N1 virus has been detected, said the Ministry of Social Affairs in Dresden on Thursday. The farm in the county Goerlitz was reportedly immediately shut off. Was initially unclear yet whether it is for humans to the virus is dangerous. The investigations resulted in the Friedrich-Loeffler-Institute through. Latest on Friday, a result available. Precaution will already killing of the stock prepared, it said. Except ducks at the affected Geflügelhof the reportedly also turkeys, geese and chickens kept. Last bird flu occurred last December when a private operator to chickens.
By Naomi Kresge
Oct. 10 (Bloomberg) --
The sick duck was found in an area with several poultry farms, including one with 70,000 animals, Schreiber said.
To contact the reporter on this story: Naomi Kresge (http://search.bloomberg.com/search?q=Naomi+Kresge&site=wnews&client=wnews&proxystylesheet=wnews&output=xml_no_dtd&ie=UTF-8&oe=UTF-8&filter=p&getfields=wnnis&sort=date:D:S:d1) in Berlin nkresge@bloomberg.net (nkresge@bloomberg.net)
Last Updated: October 10, 2008 06:56 EDT
http://www.bloomberg.com/apps/news?pid=20601202&sid=anbjeVSZ43tU&refer=healthcare
Media reports remain unclear on the health of the H5N1 positive duck. Some say the duck was sick or dead, while others say it was asymptomatic.
09 Oct 2008 18:57:19 GMT
Source: Reuters
BERLIN, Oct 9 (Reuters) - The German state of Saxony said on Thursday the H5N1 bird flu strain had been detected in a duck at a farm near Dresden late on Wednesday.
"Tests are being carried out to determine whether it is the highly contagious version of the epidemic," said Ralph Schreiber, spokesman for Saxony's social welfare ministry.
The flu strain was detected in the duck during a routine examination at the farm, which held some 1,400 birds. All birds at the farm would be killed as a precaution, Schreiber said. (Reporting by Paul Carrel)
http://www.alertnet.org/thenews/newsdesk/L994724.htm
http://www.umweltjournal.de/fp/archiv/AfA_naturkost/14769.php
http://maps.google.com/maps/ms?ie=UTF8&hl=en&msa=0&msid=106484775090296685271.000434e9d3e9066b4203c&ll=51.279958,14.975739&spn=3.154111,7.437744&z=7
Germany Kills 1,400 Fowl After First 2008 Bird Flu (Update1)
By Naomi Kresge
Oct. 10 (Bloomberg) --
[B]German authorities killed 1,400 domestic fowl after identifying the country's first case of avian influenza this year on a commercial farm in the town of Markersdorf, near the Polish border.
A duck tested positive for the H5N1 strain of bird flu, Elke Reinking, a spokeswoman for Germany's Friedrich Loeffler Institute, said in a telephone interview today.
Tests confirmed that the animal was infected with the highly pathogenic form of the disease that spreads rapidly among birds, she said.
Authorities began killing poultry at 4 a.m. and have set up a three-kilometer (1.9 mile) quarantine, said Ralph Schreiber, a Health Ministry spokesman in the German state of Saxony.
The sick duck was found in an area with several poultry farms, including one with 70,000 animals, Schreiber said.
``The flu can appear again at any time, but it was a bit of a surprise to see it in a commercially raised animal,'' Reinking said.
The Friedrich Loeffler Institute is a center for animal health.
Avian flu was last found in Germany in December 2007 in chickens at a small hobby farm, she said.
There have been no reports of the disease in neighboring countries since March, when a wild duck tested positive in Switzerland.
How the duck caught the virus remains a mystery, Reinking said.
Authorities are testing all fowl in the quarantine area to see whether the disease has spread.
Pandemic
Health authorities have been monitoring the H5N1 strain of avian influenza for more than a decade for any sign that it is becoming as contagious as seasonal flu. While millions of birds have been infected, fewer than 400 people are reported to have contracted the illness, including 36 this year.
The world is closer to another influenza pandemic than at any time since 1968, when the last of the previous century's three pandemics occurred, according to the Geneva-based World Health Organization.
The H5N1 virus has spread to more than 60 countries and caused at least 6,500 poultry outbreaks since 2003. The H5N1 flu strain is known to have infected 387 people in 15 nations in the past five years, 245 of whom have died, according to the WHO.
To contact the reporter on this story: Naomi Kresge in Berlin nkresge@bloomberg.net
Last Updated: October 10, 2008 09:56 EDT
--
Bloomberg.com: Germany (http://www.bloomberg.com/apps/news?pid=20601100&sid=anbjeVSZ43tU&refer=germany)
http://www.mz-web.de/servlet/ContentServer?pagename=ksta/page&atype=ksArtikel&aid=1223617951210&openMenu=1013083806405&calledPageId=1013083806405&listid=0
http://www.recombinomics.com/News/10090801/H5N1_Germany_Fujian.htmlCommentary
Fujian H5N1 in Germany?
Recombinomics Commentary 19:46
October 9, 2008
Authorities say a duck at a farm in eastern Germany has tested positive for the H5N1 strain of the bird flu virus.
The social affairs ministry in the eastern state of Saxony says the farm near Goerlitz on the Polish border has been sealed off.
The ministry said Thursday that the farm has more than 1,000 birds, including turkeys and geese.
The above comments on confirmed H5N1 in Germany (see satellite map (http://maps.google.com/maps/ms?ie=UTF8&hl=en&msa=0&msid=106484775090296685271.000434e9d3e9066b4203c&ll=51.279958,14.975739&spn=3.154111,7.437744&z=7)) are curious. In the past, outbreaks in Germany have predated subsequent infections in Europe. H5N1 first migrated into the area in the fall of 2005, but most outbreaks in Europe, including Germany (http://www.recombinomics.com/News/04060701/H5N1_Eagle_Owl_M230I.html) were not reported until early 2006. H5N1 was widespread in Germany and represented at least 3 distinct clade 2.2 (Qinghai strain) sub-clades.
Although there was little activity in the 2006/2007 season, Germany (http://www.recombinomics.com/News/07210701/H5N1_Endemic_Europe.html) reported multiple outbreaks in the summer of 2007, which was unexpected. Additional outbreaks were also reported in the Czech Republic and France. The isolates in Germany (http://www.recombinomics.com/News/07100701/H5N1_Nuremberg_Increase.html), including Saxony (http://www.recombinomics.com/News/07130701/H5N1_Saxony_Endemic.html), were analyzed by FLI, who noted that the 2007 isolates were distinct from 2006 and presented a clade 2.2.3 sub-clade that had been reported previously in the Uvs Lake region in Mongolia and Russia. This Uvs lake strain subsequently spread throughout Europe in the 2007/2008 season (http://www.recombinomics.com/News/01150803/H5N1_Uva_Lake_Emerge.html) and was recently reported in Nigeria (and is likely also involved in the recent outbreaks in Benin and Togo).
The latest outbreak may be signaling early arrivals from Siberia and Mongolia, which may include a new sub-clade for Europe, clade 2.3 (Fujian strain). Last spring clade 2.3.2 (http://www.recombinomics.com/News/05190803/H5N1_232_234.html) was responsible for outbreaks in South Korea (http://www.recombinomics.com/News/05210802/H5N1_Japan_Korea_Match.html), Japan (http://www.recombinomics.com/News/05190801/H5N1_Hokkaido_M230I.html), and southeastern Russia (http://www.recombinomics.com/News/09280801/Russia_Fujian_Spread.html). In northern Japan there were multiple outbreaks in whooper swans, which would be expected to create opportunities for migration of H5N1 to the same areas that gave rise to clade 2.2.3. Thus, the sequences of the H5N1 would be of interest. Previously, all H5N1 west of China has been clade 2.2. If the H5N1 in Germany is clade 2.3, it would signal a major global expansion of this sub-clade, which ahs been responsible for all reported human cases in China, as well as recent cases in Vietnam.
. (http://www.flutrackers.com/forum/showthread.php?t=82519)
09 Oct 2008 19:48:49 GMT
Source: Reuters
(Adds detail, background)
BERLIN, Oct 9 (Reuters) - The German state of Saxony said on Thursday the H5N1 bird flu strain had been detected in a duck at a poultry farm near Dresden late on Wednesday.
"Tests are being carried out to determine whether it is the highly contagious version of the epidemic," said Ralph Schreiber, spokesman for Saxony's social welfare ministry.
The flu strain was detected in the duck during a routine examination at the farm, which held some 1,400 birds. All birds at the farm would be killed as a precaution, Schreiber said, adding that access to the farm was blocked off.
Bird flu was last detected at a farm in Saxony in 2006. Last year, seven wild birds were found with the virus in the eastern state, Schreiber said.
The virus has infected 387 people in 15 countries, killing 245 of them, according to the World Health Organisation's Aug. 10 tally. Indonesia has the highest toll of any nation.
Although bird flu remains an animal disease, experts fear that the virus might mutate into a form easily passed from human to human, sparking a pandemic in which case millions could die. (Reporting by Paul Carrel; editing by Jim Marshall)
http://www.alertnet.org/thenews/newsdesk/L9475613.htm
The Associated Press
Thursday, October 9, 2008
DRESDEN, Germany: Authorities say a duck at a farm in eastern Germany has tested positive for the H5N1 strain of the bird flu virus.
The social affairs ministry in the eastern state of Saxony says the farm near Goerlitz on the Polish border has been sealed off.
The ministry said Thursday that the farm has more than 1,000 birds, including turkeys and geese.
Germany has seen several cases of bird flu in the past — most recently in December.
The disease has ravaged poultry stocks in Asia, and scientists believe it spread to both Europe and Africa with migratory wild birds.
Though bird flu is difficult for people to catch, the H5N1 strain has killed at least 206 people worldwide.
http://www.iht.com/bin/printfriendly.php?id=16822147
Lower Saxony has for 12 percent of the population against bird flu - Large businesses before
Von Cornelia Steiner By Cornelia Steiner
[/URL] BRUNSWICK. For chickens, ducks and geese had in the past two years repeatedly kept indoors. This should prevent migratory birds which domestic poultry with the bird flu virus infect. This year there were poultry nationwide only one case of bird flu, also called avian influenza. A stall duty has not been prescribed.
Why the virus can be dangerous for humans?
Bird flu spreads from Asia coming from. So far, only the virus from animal to animal or from animals to humans. Flu viruses change constantly, however. Doctors fear so that it eventually mutate and among humans could spread.
"The virus would then have immediate global importance because, for example through coughing or sneezing is transmitted and thus spreads very quickly," says Rudi Balling, director of the Helmholtz Center for Infection Research in Brunswick.
The sudden outbreak of infectious disease SARS in 2003 has shown how quickly a pathogen can occur worldwide. The origin lay in Southeast Asia, but shortly afterwards were also infected people in Canada - the lung virus was on the plane mitgereist. Around 900 people have died worldwide at that time.
How can we protect ourselves?
"We must be proactive and take measures without panic, and everyone in his field," says Rudi Balling. To build the Helmholtz Institute with the Hanover Medical School Department of Virology at.
Braunschweiger researchers also will cooperate with the bird flu virus deal.
The provinces also provide before. They have stocks of flu Tamiflu and Relenza funds created. The Robert Koch Institute recommends a stock for 20 percent of the population. This could provide different scenarios that all patients be treated while until a vaccine is produced.
Lower Saxony has a stock for roughly 12 percent of the population.
"We rely on our screening system. The opportunity, thus the threat of a pandemic early to detect and combat is very high," says Christian Stichternath, spokesman for the Ministry of Social Affairs.
Public institutions and large corporations have also ordered medication. "Of course there is a pandemic in our planning, as in the usual big industry," said a Volkswagen spokesman. Details are not known.
Monday, 20.10.2008 :tiphat:[URL]http://www.newsclick.de/index.jsp/menuid/2046/artid/9306653 (http://209.85.171.104/translate_c?hl=en&sl=de&tl=en&u=http://www.newsclick.de/index.jsp/menuid/2046/include/2f67616c65726965732f73696e676c65496d6167652e6a7370/imageId/9306654/artid/9306653&usg=ALkJrhgfqW9UkEqcMYy4DjEu1xf9vnzrSg)
http://www.sonntagszeitung.ch/home/artikel-detailseite-sda/?newsid=45963
Google translation:
Third case of "bird flu" in Saxony
Werner Hupperich 18.10.2008 13:07 Topics: biopolitics
There were apparently already on 02 October for further infection cases of "bird flu" in Saxony, on which the public, however, was not informed.
Third case of "bird flu" in Saxony - the public was not informed
As the OIE report (Ref OIE 7439), 17 October to show that there was apparently already on 02 October for further infection cases in Saxony. For a Stadtgut Mölkau located near Leipzig poultry livestock were influenza virus type H5 demonstrated. According to the OIE report were the 106 animals in the poultry immediately after detection of the virus killed. According to the OIE is the exact determination of the neuraminidase from the Friedrich-Loeffler-Institute until today. Whether it's the same, low-pathogenic H5N3 virus is, as he seems simultaneously in Leipzig in four zoo animals, is currently uncertain. Is also unclear why the public in case of outbreak in Stadtgut Mölkau despite 106 affected animals was not promptly informed. Werner Hupperich / WAI
V.d.i.S.d.P.:
Werner Hupperich
WAI - Science Forum avian influenza
Gottliebstraße 57
47166 Duisburg
E-mail: werner.hupperich @ wai.netzwerk-phoenix.net
Internet: www.wai.netzwerk-phoenix.net
#If you have any other info about this subject , Please add it free.# |
| More »